/* I/O of multiple sequence alignments in PSI-BLAST format * * Contents: * 1. API for reading/writing PSI-BLAST format * 2. Unit tests. * 3. Test driver. * 4. Examples. */ #include #include #include #include #include "easel.h" #include "esl_alphabet.h" #include "esl_mem.h" #include "esl_msa.h" #include "esl_msafile.h" #include "esl_msafile_psiblast.h" /***************************************************************** *# 1. API for reading/writing PSI-BLAST format *****************************************************************/ /* Function: esl_msafile_psiblast_SetInmap() * Synopsis: Set input map specific for PSI-BLAST input. * * Purpose: Set the inmap> for PSI-BLAST format. * * PSI-BLAST only allows - for a gap. It also disallows O residues. * * Text mode accepts any character plus '-' but not 'O' or 'o'. * Digital mode enforces the usual Easel alphabets, but disallows "._*~". */ int esl_msafile_psiblast_SetInmap(ESL_MSAFILE *afp) { int sym; if (afp->abc) { for (sym = 0; sym < 128; sym++) afp->inmap[sym] = afp->abc->inmap[sym]; afp->inmap[0] = esl_abc_XGetUnknown(afp->abc); afp->inmap['.'] = eslDSQ_ILLEGAL; afp->inmap['_'] = eslDSQ_ILLEGAL; afp->inmap['*'] = eslDSQ_ILLEGAL; afp->inmap['~'] = eslDSQ_ILLEGAL; } if (! afp->abc) { for (sym = 1; sym < 128; sym++) afp->inmap[sym] = (isalpha(sym) ? sym : eslDSQ_ILLEGAL); afp->inmap[0] = '?'; afp->inmap['-'] = '-'; } afp->inmap['O'] = eslDSQ_ILLEGAL; afp->inmap['o'] = eslDSQ_ILLEGAL; return eslOK; } /* Function: esl_msafile_psiblast_GuessAlphabet() * Synopsis: Guess the alphabet of an open PSI-BLAST MSA file. * * Purpose: Guess the alpbabet of the sequences in open * PSI-BLAST format MSA file . * * On a normal return, <*ret_type> is set to , * , or , and is reset to its * original position. * * Args: afp - open PSI-BLAST format MSA file * ret_type - RETURN: , , or * * Returns: on success. * if alphabet type can't be determined. * In either case, is rewound to the position it * started at. */ int esl_msafile_psiblast_GuessAlphabet(ESL_MSAFILE *afp, int *ret_type) { int alphatype = eslUNKNOWN; esl_pos_t anchor = -1; int threshold[3] = { 500, 5000, 50000 }; /* we check after 500, 5000, 50000 residues; else we go to EOF */ int nsteps = 3; int step = 0; int nres = 0; int x; int64_t ct[26]; char *p, *tok; esl_pos_t n, toklen, pos; int status; for (x = 0; x < 26; x++) ct[x] = 0; anchor = esl_buffer_GetOffset(afp->bf); if ((status = esl_buffer_SetAnchor(afp->bf, anchor)) != eslOK) { status = eslEINCONCEIVABLE; goto ERROR; } /* [eslINVAL] can't happen here */ while ( (status = esl_buffer_GetLine(afp->bf, &p, &n)) == eslOK) { if ((status = esl_memtok(&p, &n, " \t", &tok, &toklen)) != eslOK) continue; /* blank lines */ /* p now points to the rest of the sequence line, after a name */ /* count characters into ct[] array */ for (pos = 0; pos < n; pos++) if (isalpha(p[pos])) { x = toupper(p[pos]) - 'A'; ct[x]++; nres++; } /* try to stop early, checking after 500, 5000, and 50000 residues: */ if (step < nsteps && nres > threshold[step]) { if ((status = esl_abc_GuessAlphabet(ct, &alphatype)) == eslOK) goto DONE; /* (eslENOALPHABET) */ step++; } } if (status != eslEOF) goto ERROR; /* [eslEMEM,eslESYS,eslEINCONCEIVABLE] */ status = esl_abc_GuessAlphabet(ct, &alphatype); /* (eslENOALPHABET) */ DONE: esl_buffer_SetOffset(afp->bf, anchor); /* Rewind to where we were. */ esl_buffer_RaiseAnchor(afp->bf, anchor); *ret_type = alphatype; return status; ERROR: if (anchor != -1) { esl_buffer_SetOffset(afp->bf, anchor); esl_buffer_RaiseAnchor(afp->bf, anchor); } *ret_type = eslUNKNOWN; return status; } /* Function: esl_msafile_psiblast_Read() * Synopsis: Read an alignment in PSI-BLAST's input format. * * Purpose: Read an MSA from an open , parsing for * PSI-BLAST input format, starting from the current point. * Create a new multiple alignment, and return a ptr to * that alignment via <*ret_msa>. Caller is responsible for * free'ing this . * * The has a reference line (rf[]>) that * corresponds to the uppercase/lowercase columns in the * alignment: consensus (uppercase) columns are marked 'x', * and insert (lowercase) columns are marked '.' in this RF * line. * * Args: afp - open * ret_msa - RETURN: newly parsed * * Returns: on success. <*ret_msa> contains the newly * allocated MSA. is at EOF. * * if no (more) alignment data are found in * , and is returned at EOF. * * on a parse error. <*ret_msa> is set to * . contains information sufficient for * constructing useful diagnostic output: * | errmsg> | user-directed error message | * | linenumber> | line # where error was detected | * | line> | offending line (not NUL-term) | * | n> | length of offending line | * | bf->filename> | name of the file | * and is poised at the start of the following line, * so (in principle) the caller could try to resume * parsing. * * Throws: on allocation error. * if a system call fails, such as fread(). * - "impossible" corruption * On these, <*ret_msa> is returned , and the state of * is undefined. */ int esl_msafile_psiblast_Read(ESL_MSAFILE *afp, ESL_MSA **ret_msa) { ESL_MSA *msa = NULL; int idx = 0; /* counter over sequences in a block */ int nblocks = 0; /* counter over blocks */ int64_t alen = 0; int nseq = 0; int64_t cur_alen; esl_pos_t pos; /* position on a line */ esl_pos_t name_start, name_len; esl_pos_t seq_start, seq_len; esl_pos_t block_seq_start, block_seq_len; int status; ESL_DASSERT1( (afp->format == eslMSAFILE_PSIBLAST) ); afp->errmsg[0] = '\0'; /* allocate a growable MSA. We set msa->{nseq,alen} only when we're done. */ if (afp->abc && (msa = esl_msa_CreateDigital(afp->abc, 16, -1)) == NULL) { status = eslEMEM; goto ERROR; } if (! afp->abc && (msa = esl_msa_Create( 16, -1)) == NULL) { status = eslEMEM; goto ERROR; } /* skip leading blank lines in file */ while ( (status = esl_msafile_GetLine(afp, NULL, NULL)) == eslOK && esl_memspn(afp->line, afp->n, " \t") == afp->n) ; if (status != eslOK) goto ERROR; /* includes normal EOF */ /* Read the file a line at a time; if a parsing error occurs, detect immediately, with afp->linenumber set correctly */ do { /* while in the file... */ idx = 0; do { /* while in a block... */ for (pos = 0; pos < afp->n; pos++) if (! isspace(afp->line[pos])) break; name_start = pos; for (pos = pos+1; pos < afp->n; pos++) if ( isspace(afp->line[pos])) break; name_len = pos - name_start; for (pos = pos+1; pos < afp->n; pos++) if (! isspace(afp->line[pos])) break; seq_start = pos; if (pos >= afp->n) ESL_XFAIL(eslEFORMAT, afp->errmsg, "invalid alignment line"); for (pos = afp->n-1; pos > 0; pos--) if (! isspace(afp->line[pos])) break; seq_len = pos - seq_start + 1; if (idx == 0) { block_seq_start = seq_start; block_seq_len = seq_len; } else { if (seq_start != block_seq_start) ESL_XFAIL(eslEFORMAT, afp->errmsg, "sequence start is misaligned"); if (seq_len != block_seq_len) ESL_XFAIL(eslEFORMAT, afp->errmsg, "sequence end is misaligned"); } /* Process the consensus #=RF line. */ if (idx == 0) { ESL_REALLOC(msa->rf, sizeof(char) * (alen + seq_len + 1)); for (pos = 0; pos < seq_len; pos++) msa->rf[alen+pos] = '-'; /* anything neutral other than . or x will do. */ msa->rf[alen+pos] = '\0'; } for (pos = 0; pos < seq_len; pos++) { if (afp->line[seq_start+pos] == '-') continue; if (isupper(afp->line[seq_start+pos])) { if (msa->rf[alen+pos] == '.') ESL_XFAIL(eslEFORMAT, afp->errmsg, "unexpected upper case residue (#%d on line)", (int) pos+1); msa->rf[alen+pos] = 'x'; } if (islower(afp->line[seq_start+pos])) { if (msa->rf[alen+pos] == 'x') ESL_XFAIL(eslEFORMAT, afp->errmsg, "unexpected lower case residue (#%d on line)", (int) pos+1); msa->rf[alen+pos] = '.'; } } /* Store the sequence name. */ if (nblocks == 0) { /* make sure we have room for another sequence */ if (idx >= msa->sqalloc && (status = esl_msa_Expand(msa)) != eslOK) goto ERROR; if ( (status = esl_msa_SetSeqName(msa, idx, afp->line+name_start, name_len)) != eslOK) goto ERROR; } else { if (! esl_memstrcmp(afp->line+name_start, name_len, msa->sqname[idx])) ESL_XFAIL(eslEFORMAT, afp->errmsg, "expected sequence %s on this line, but saw %.*s", msa->sqname[idx], (int) name_len, afp->line+name_start); } /* Append the sequence. */ cur_alen = alen; if (msa->abc) { status = esl_abc_dsqcat(afp->inmap, &(msa->ax[idx]), &(cur_alen), afp->line+seq_start, seq_len); } if (! msa->abc) { status = esl_strmapcat (afp->inmap, &(msa->aseq[idx]), &(cur_alen), afp->line+seq_start, seq_len); } if (status == eslEINVAL) ESL_XFAIL(eslEFORMAT, afp->errmsg, "one or more invalid sequence characters"); else if (status != eslOK) goto ERROR; if (cur_alen - alen != seq_len) ESL_XFAIL(eslEFORMAT, afp->errmsg, "unexpected number of seq characters"); /* get next line. if it's blank, or if we're EOF, we're done with the block */ idx++; status = esl_msafile_GetLine(afp, NULL, NULL); } while (status == eslOK && esl_memspn(afp->line, afp->n, " \t") < afp->n); /* blank line ends a block. */ if (status != eslOK && status != eslEOF) goto ERROR; /* End of one block */ if (nblocks == 0) nseq = idx; else if (idx != nseq) ESL_XFAIL(eslEFORMAT, afp->errmsg, "last block didn't contain same # of seqs as earlier blocks"); alen += block_seq_len; nblocks++; /* skip blank lines to start of next block, if any */ while ( (status = esl_msafile_GetLine(afp, NULL, NULL)) == eslOK && esl_memspn(afp->line, afp->n, " \t") == afp->n) ; } while (status == eslOK); if (status != eslEOF) goto ERROR; msa->nseq = nseq; msa->alen = alen; if (( status = esl_msa_SetDefaultWeights(msa)) != eslOK) goto ERROR; *ret_msa = msa; return eslOK; ERROR: if (msa) esl_msa_Destroy(msa); *ret_msa = NULL; return status; } /* Function: esl_msafile_psiblast_Write() * Synopsis: Write an MSA to a stream in PSI-BLAST format * * Purpose: Write alignment in NCBI PSI-BLAST format to * stream . * * The should have a valid reference line rf>, * with alphanumeric characters marking consensus (match) * columns, and non-alphanumeric characters marking * nonconsensus (insert) columns. If it does not have RF * annotation, then the first sequence in the * defines the "consensus". * * PSI-BLAST format allows only one symbol ('-') for gaps, * and cannot represent missing data symbols (Easel's * '~'). Any missing data symbols are converted to gaps. * * Args: fp - open output stream * msa - MSA to write * * Returns: on success. * * Throws: on allocation failure. * on any system write failure, such as filled disk. */ int esl_msafile_psiblast_Write(FILE *fp, const ESL_MSA *msa) { char *buf = NULL; int cpl = 60; int acpl; int i; int sym; int64_t pos, bpos; int maxnamewidth = esl_str_GetMaxWidth(msa->sqname, msa->nseq); int is_consensus; int is_residue; int status; ESL_ALLOC(buf, sizeof(char) * (cpl+1)); for (pos = 0; pos < msa->alen; pos += cpl) { for (i = 0; i < msa->nseq; i++) { acpl = (msa->alen - pos > cpl)? cpl : msa->alen - pos; if (msa->abc) { for (bpos = 0; bpos < acpl; bpos++) { sym = msa->abc->sym[msa->ax[i][pos + bpos + 1]]; is_residue = esl_abc_XIsResidue(msa->abc, msa->ax[i][pos+bpos+1]); if (msa->rf) is_consensus = (isalnum(msa->rf[pos + bpos]) ? TRUE : FALSE); else is_consensus = (esl_abc_XIsResidue(msa->abc, msa->ax[0][pos+bpos+1]) ? TRUE : FALSE); if (is_consensus) { buf[bpos] = (is_residue ? toupper(sym) : '-'); } else { buf[bpos] = (is_residue ? tolower(sym) : '-'); } } } if (! msa->abc) { for (bpos = 0; bpos < acpl; bpos++) { sym = msa->aseq[i][pos + bpos]; is_residue = isalnum(sym); if (msa->rf) is_consensus = (isalnum(msa->rf[pos + bpos]) ? TRUE : FALSE); else is_consensus = (isalnum(msa->aseq[0][pos+bpos]) ? TRUE : FALSE); if (is_consensus) { buf[bpos] = (is_residue ? toupper(sym) : '-'); } else { buf[bpos] = (is_residue ? tolower(sym) : '-'); } } } buf[acpl] = '\0'; if (fprintf(fp, "%-*s %s\n", maxnamewidth, msa->sqname[i], buf) < 0) ESL_XEXCEPTION_SYS(eslEWRITE, "psiblast msa write failed"); } /* end loop over sequences */ if (pos + cpl < msa->alen) { if (fputc('\n', fp) < 0) ESL_XEXCEPTION_SYS(eslEWRITE, "psiblast msa write failed"); } } free(buf); return eslOK; ERROR: if (buf) free(buf); return status; } /*----------- end, API for i/o of psi-blast format --------------*/ /***************************************************************** * 2. Unit tests. *****************************************************************/ #ifdef eslMSAFILE_PSIBLAST_TESTDRIVE static void utest_write_good1(FILE *ofp, int *ret_alphatype, int *ret_nseq, int *ret_alen) { fputs("MYG_PHYCA --------V-LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKT\n", ofp); fputs("GLB5_PETMA pivdtgsvApLSAAEKTKIRSAWAPVYSTYETSGVDILVKFFTSTPAAQEFFPKFKGLTT\n", ofp); fputs("HBB_HUMAN --------VhLTPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLST\n", ofp); fputs("HBA_HUMAN --------V-LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHF-----\n", ofp); fputs("\n", ofp); fputs("MYG_PHYCA EAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHATKHKIPIKYLEFIS\n", ofp); fputs("GLB5_PETMA ADQLKKSADVRWHAERIINAVNDAVASMDDtekMSMKLRDLSGKHAKSFQVDPQYFKVLA\n", ofp); fputs("HBB_HUMAN PDAVMGNPKVKAHGKKVLGAFSDGLAHLDN---LKGTFATLSELHCDKLHVDPENFRLLG\n", ofp); fputs("HBA_HUMAN -DLSHGSAQVKGHGKKVADALTNAVAHVDD---MPNALSALSDLHAHKLRVDPVNFKLLS\n", ofp); fputs("\n", ofp); fputs("MYG_PHYCA EAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG\n", ofp); fputs("GLB5_PETMA AVI---------ADTVAAGDAGFEKLMSMICILLRSAY-------\n", ofp); fputs("HBB_HUMAN NVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH------\n", ofp); fputs("HBA_HUMAN HCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR------\n", ofp); *ret_alphatype = eslAMINO; *ret_nseq = 4; *ret_alen = 165; } static void utest_write_good2(FILE *ofp, int *ret_alphatype, int *ret_nseq, int *ret_alen) { fputs("tRNA2 UCCGAUAUAGUGUAACGGCUAUCACAUCACGCUUUCACCGUGG-AGACCGGGGUUCGACU\n", ofp); fputs("tRNA3 UCCGUGAUAGUUUAAUGGUCAGAAUGG-GCGCUUGUCGCGUGCcAGAUCGGGGUUCAAUU\n", ofp); fputs("tRNA5 GGGCACAUGGCGCAGUUGGUAGCGCGCUUCCCUUGCAAGGAAGaGGUCAUCGGUUCGAUU\n", ofp); fputs("tRNA1 GCGGAUUUAGCUCAGUUGGGAGAGCGCCAGACUGAAGAUCUGGaGGUCCUGUGUUCGAUC\n", ofp); fputs("tRNA4 GCUCGUAUGGCGCAGUGG-UAGCGCAGCAGAUUGCAAAUCUGUuGGUCCUUAGUUCGAUC\n", ofp); fputs("\n", ofp); fputs("tRNA2 CCCCGUAUCGGAG\n", ofp); fputs("tRNA3 CCCCGUCGCGGAG\n", ofp); fputs("tRNA5 CCGGUUGCGUCCA\n", ofp); fputs("tRNA1 CACAGAAUUCGCA\n", ofp); fputs("tRNA4 CUGAGUGCGAGCU\n", ofp); *ret_alphatype = eslRNA; *ret_nseq = 5; *ret_alen = 73; } static void utest_goodfile(char *filename, int testnumber, int expected_alphatype, int expected_nseq, int expected_alen) { ESL_ALPHABET *abc = NULL; ESL_MSAFILE *afp = NULL; ESL_MSA *msa1 = NULL; ESL_MSA *msa2 = NULL; char tmpfile1[32] = "esltmpXXXXXX"; char tmpfile2[32] = "esltmpXXXXXX"; FILE *ofp = NULL; int status; /* guessing both the format and the alphabet should work: this is a digital open */ /* PSIBLAST format is autodetected as SELEX, which is fine - selex parser is more general */ if ( (status = esl_msafile_Open(&abc, filename, NULL, eslMSAFILE_UNKNOWN, NULL, &afp)) != eslOK) esl_fatal("psiblast good file test %d failed: digital open", testnumber); if (afp->format != eslMSAFILE_SELEX) esl_fatal("psiblast good file test %d failed: format autodetection", testnumber); if (abc->type != expected_alphatype) esl_fatal("psiblast good file test %d failed: alphabet autodetection", testnumber); afp->format = eslMSAFILE_PSIBLAST; /* This is a digital read, using . */ if ( (status = esl_msafile_psiblast_Read(afp, &msa1)) != eslOK) esl_fatal("psiblast good file test %d failed: msa read, digital", testnumber); if (msa1->nseq != expected_nseq || msa1->alen != expected_alen) esl_fatal("psiblast good file test %d failed: nseq/alen", testnumber); if (esl_msa_Validate(msa1, NULL) != eslOK) esl_fatal("psiblast good file test %d failed: msa1 invalid", testnumber); esl_msafile_Close(afp); /* write it back out to a new tmpfile (digital write) */ if ( (status = esl_tmpfile_named(tmpfile1, &ofp)) != eslOK) esl_fatal("psiblast good file test %d failed: tmpfile creation", testnumber); if ( (status = esl_msafile_psiblast_Write(ofp, msa1)) != eslOK) esl_fatal("psiblast good file test %d failed: msa write, digital", testnumber); fclose(ofp); /* now open and read it as text mode, in known format. (We have to pass fmtd now, to deal with the possibility of a nonstandard name width) */ if ( (status = esl_msafile_Open(NULL, tmpfile1, NULL, eslMSAFILE_PSIBLAST, NULL, &afp)) != eslOK) esl_fatal("psiblast good file test %d failed: text mode open", testnumber); if ( (status = esl_msafile_psiblast_Read(afp, &msa2)) != eslOK) esl_fatal("psiblast good file test %d failed: msa read, text", testnumber); if (msa2->nseq != expected_nseq || msa2->alen != expected_alen) esl_fatal("psiblast good file test %d failed: nseq/alen", testnumber); if (esl_msa_Validate(msa2, NULL) != eslOK) esl_fatal("psiblast good file test %d failed: msa2 invalid", testnumber); esl_msafile_Close(afp); /* write it back out to a new tmpfile (text write) */ if ( (status = esl_tmpfile_named(tmpfile2, &ofp)) != eslOK) esl_fatal("psiblast good file test %d failed: tmpfile creation", testnumber); if ( (status = esl_msafile_psiblast_Write(ofp, msa2)) != eslOK) esl_fatal("psiblast good file test %d failed: msa write, text", testnumber); fclose(ofp); esl_msa_Destroy(msa2); /* open and read it in digital mode */ if ( (status = esl_msafile_Open(&abc, tmpfile1, NULL, eslMSAFILE_PSIBLAST, NULL, &afp)) != eslOK) esl_fatal("psiblast good file test %d failed: 2nd digital mode open", testnumber); if ( (status = esl_msafile_psiblast_Read(afp, &msa2)) != eslOK) esl_fatal("psiblast good file test %d failed: 2nd digital msa read", testnumber); if (esl_msa_Validate(msa2, NULL) != eslOK) esl_fatal("psiblast good file test %d failed: msa2 invalid", testnumber); esl_msafile_Close(afp); /* this msa should be identical to */ if (esl_msa_Compare(msa1, msa2) != eslOK) esl_fatal("psiblast good file test %d failed: msa compare", testnumber); remove(tmpfile1); remove(tmpfile2); esl_msa_Destroy(msa1); esl_msa_Destroy(msa2); esl_alphabet_Destroy(abc); } static void write_test_msas(FILE *ofp1, FILE *ofp2) { fprintf(ofp1, "\n"); fprintf(ofp1, "seq1 --ACDEFGHIKLMNPQRSTVWY\n"); fprintf(ofp1, "seq2 --ACDEFGHIKLMNPQRSTV-- \n"); fprintf(ofp1, "seq3 aaACDEFGHIKLMNPQRSTV-- \n"); fprintf(ofp1, "seq4 --ACDEFGHIKLMNPQRSTVWY \n"); fprintf(ofp1, "\n"); fprintf(ofp1, "seq1 ACDEFGHIKLMNPQRSTVWY--\n"); fprintf(ofp1, "seq2 ACDEFGHIKLMNPQRSTVWYyy\n"); fprintf(ofp1, "seq3 ACDEFGHIKLMNPQRSTVWY--\n"); fprintf(ofp1, "seq4 ACDEFGHIKLMNPQRSTVWY--\n"); fprintf(ofp1, "\n"); fprintf(ofp2, "# STOCKHOLM 1.0\n"); fprintf(ofp2, "\n"); fprintf(ofp2, "#=GC RF ..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..\n"); fprintf(ofp2, "seq1 --ACDEFGHIKLMNPQRSTVWYACDEFGHIKLMNPQRSTVWY--\n"); fprintf(ofp2, "seq2 --ACDEFGHIKLMNPQRSTV--ACDEFGHIKLMNPQRSTVWYyy\n"); fprintf(ofp2, "seq3 aaACDEFGHIKLMNPQRSTV--ACDEFGHIKLMNPQRSTVWY--\n"); fprintf(ofp2, "seq4 --ACDEFGHIKLMNPQRSTVWYACDEFGHIKLMNPQRSTVWY--\n"); fprintf(ofp2, "//\n"); } static void read_test_msas_digital(char *pbfile, char *stkfile) { char msg[] = "PSIBLAST msa digital read unit test failed"; ESL_ALPHABET *abc = NULL; ESL_MSAFILE *afp1 = NULL; ESL_MSAFILE *afp2 = NULL; ESL_MSA *msa1, *msa2, *msa3, *msa4; FILE *pbfp, *stkfp; char pbfile2[32] = "esltmppb2XXXXXX"; char stkfile2[32] = "esltmpstk2XXXXXX"; if ( esl_msafile_Open(&abc, pbfile, NULL, eslMSAFILE_PSIBLAST, NULL, &afp1) != eslOK) esl_fatal(msg); if ( !abc || abc->type != eslAMINO) esl_fatal(msg); if ( esl_msafile_Open(&abc, stkfile, NULL, eslMSAFILE_STOCKHOLM, NULL, &afp2) != eslOK) esl_fatal(msg); if ( esl_msafile_psiblast_Read (afp1, &msa1) != eslOK) esl_fatal(msg); if ( esl_msafile_stockholm_Read(afp2, &msa2) != eslOK) esl_fatal(msg); if ( esl_msa_Compare(msa1, msa2) != eslOK) esl_fatal(msg); if ( esl_msafile_psiblast_Read (afp1, &msa3) != eslEOF) esl_fatal(msg); if ( esl_msafile_stockholm_Read(afp2, &msa3) != eslEOF) esl_fatal(msg); esl_msafile_Close(afp2); esl_msafile_Close(afp1); /* Now write stk to psiblast file, and vice versa; then retest */ if ( esl_tmpfile_named(pbfile2, &pbfp) != eslOK) esl_fatal(msg); if ( esl_tmpfile_named(stkfile2, &stkfp) != eslOK) esl_fatal(msg); if ( esl_msafile_psiblast_Write (pbfp, msa2) != eslOK) esl_fatal(msg); if ( esl_msafile_stockholm_Write(stkfp, msa1, eslMSAFILE_STOCKHOLM) != eslOK) esl_fatal(msg); fclose(pbfp); fclose(stkfp); if ( esl_msafile_Open(&abc, pbfile2, NULL, eslMSAFILE_PSIBLAST, NULL, &afp1) != eslOK) esl_fatal(msg); if ( esl_msafile_Open(&abc, stkfile2, NULL, eslMSAFILE_STOCKHOLM, NULL, &afp2) != eslOK) esl_fatal(msg); if ( esl_msafile_psiblast_Read (afp1, &msa3) != eslOK) esl_fatal(msg); if ( esl_msafile_stockholm_Read(afp2, &msa4) != eslOK) esl_fatal(msg); if ( esl_msa_Compare(msa3, msa4) != eslOK) esl_fatal(msg); remove(pbfile2); remove(stkfile2); esl_msafile_Close(afp2); esl_msafile_Close(afp1); esl_msa_Destroy(msa1); esl_msa_Destroy(msa2); esl_msa_Destroy(msa3); esl_msa_Destroy(msa4); esl_alphabet_Destroy(abc); } static void read_test_msas_text(char *pbfile, char *stkfile) { char msg[] = "PSIBLAST msa text-mode read unit test failed"; ESL_MSAFILE *afp1 = NULL; ESL_MSAFILE *afp2 = NULL; ESL_MSA *msa1, *msa2, *msa3, *msa4; FILE *pbfp, *stkfp; char pbfile2[32] = "esltmppb2XXXXXX"; char stkfile2[32] = "esltmpstk2XXXXXX"; /* vvvv-- everything's the same as the digital utest except these NULLs */ if ( esl_msafile_Open(NULL, pbfile, NULL, eslMSAFILE_PSIBLAST, NULL, &afp1) != eslOK) esl_fatal(msg); if ( esl_msafile_Open(NULL, stkfile, NULL, eslMSAFILE_STOCKHOLM, NULL, &afp2) != eslOK) esl_fatal(msg); if ( esl_msafile_psiblast_Read (afp1, &msa1) != eslOK) esl_fatal(msg); if ( esl_msafile_stockholm_Read(afp2, &msa2) != eslOK) esl_fatal(msg); if ( esl_msa_Compare(msa1, msa2) != eslOK) esl_fatal(msg); if ( esl_msafile_psiblast_Read (afp1, &msa3) != eslEOF) esl_fatal(msg); if ( esl_msafile_stockholm_Read(afp2, &msa3) != eslEOF) esl_fatal(msg); esl_msafile_Close(afp2); esl_msafile_Close(afp1); if ( esl_tmpfile_named(pbfile2, &pbfp) != eslOK) esl_fatal(msg); if ( esl_tmpfile_named(stkfile2, &stkfp) != eslOK) esl_fatal(msg); if ( esl_msafile_psiblast_Write (pbfp, msa2) != eslOK) esl_fatal(msg); if ( esl_msafile_stockholm_Write(stkfp, msa1, eslMSAFILE_STOCKHOLM) != eslOK) esl_fatal(msg); fclose(pbfp); fclose(stkfp); if ( esl_msafile_Open(NULL, pbfile2, NULL, eslMSAFILE_PSIBLAST, NULL, &afp1) != eslOK) esl_fatal(msg); if ( esl_msafile_Open(NULL, stkfile2, NULL, eslMSAFILE_STOCKHOLM, NULL, &afp2) != eslOK) esl_fatal(msg); if ( esl_msafile_psiblast_Read (afp1, &msa3) != eslOK) esl_fatal(msg); if ( esl_msafile_stockholm_Read(afp2, &msa4) != eslOK) esl_fatal(msg); if ( esl_msa_Compare(msa3, msa4) != eslOK) esl_fatal(msg); remove(pbfile2); remove(stkfile2); esl_msafile_Close(afp2); esl_msafile_Close(afp1); esl_msa_Destroy(msa1); esl_msa_Destroy(msa2); esl_msa_Destroy(msa3); esl_msa_Destroy(msa4); } #endif /*eslMSAFILE_PSIBLAST_TESTDRIVE*/ /*---------------------- end, unit tests ------------------------*/ /***************************************************************** * 3. Test driver. *****************************************************************/ #ifdef eslMSAFILE_PSIBLAST_TESTDRIVE /* compile: gcc -g -Wall -I. -L. -o esl_msafile_psiblast_utest -DeslMSAFILE_PSIBLAST_TESTDRIVE esl_msafile_psiblast.c -leasel -lm * (gcov): gcc -g -Wall -fprofile-arcs -ftest-coverage -I. -L. -o esl_msafile_psiblast_utest -DeslMSAFILE_PSIBLAST_TESTDRIVE esl_msafile_psiblast.c -leasel -lm * run: ./esl_msafile_psiblast_utest */ #include #include #include "easel.h" #include "esl_getopts.h" #include "esl_random.h" #include "esl_msafile.h" #include "esl_msafile_psiblast.h" static ESL_OPTIONS options[] = { /* name type default env range togs reqs incomp help docgrp */ {"-h", eslARG_NONE, FALSE, NULL, NULL, NULL, NULL, NULL, "show help and usage", 0}, { 0,0,0,0,0,0,0,0,0,0}, }; static char usage[] = "[-options]"; static char banner[] = "test driver for PSIBLAST MSA format module"; int main(int argc, char **argv) { char msg[] = "PSI-BLAST MSA i/o module test driver failed"; ESL_GETOPTS *go = esl_getopts_CreateDefaultApp(options, 0, argc, argv, banner, usage); char pbfile[32] = "esltmppbXXXXXX"; char stkfile[32] = "esltmpstkXXXXXX"; FILE *pbfp, *stkfp; int testnumber; int ngoodtests = 2; char tmpfile[32]; FILE *ofp; int expected_alphatype; int expected_nseq; int expected_alen; if ( esl_tmpfile_named(pbfile, &pbfp) != eslOK) esl_fatal(msg); if ( esl_tmpfile_named(stkfile, &stkfp) != eslOK) esl_fatal(msg); write_test_msas(pbfp, stkfp); fclose(pbfp); fclose(stkfp); read_test_msas_digital(pbfile, stkfile); read_test_msas_text (pbfile, stkfile); /* Various "good" files that should be parsed correctly */ for (testnumber = 1; testnumber <= ngoodtests; testnumber++) { strcpy(tmpfile, "esltmpXXXXXX"); if (esl_tmpfile_named(tmpfile, &ofp) != eslOK) esl_fatal(msg); switch (testnumber) { case 1: utest_write_good1 (ofp, &expected_alphatype, &expected_nseq, &expected_alen); break; case 2: utest_write_good2 (ofp, &expected_alphatype, &expected_nseq, &expected_alen); break; } fclose(ofp); utest_goodfile(tmpfile, testnumber, expected_alphatype, expected_nseq, expected_alen); remove(tmpfile); } remove(pbfile); remove(stkfile); esl_getopts_Destroy(go); return 0; } #endif /*eslMSAFILE_PSIBLAST_TESTDRIVE*/ /*--------------------- end, test driver ------------------------*/ /***************************************************************** * 4. Examples. *****************************************************************/ #ifdef eslMSAFILE_PSIBLAST_EXAMPLE /* A full-featured example of reading/writing an MSA in PSIBLAST format. gcc -g -Wall -o esl_msafile_psiblast_example -I. -L. -DeslMSAFILE_PSIBLAST_EXAMPLE esl_msafile_psiblast.c -leasel -lm ./esl_msafile_psiblast_example */ /*::cexcerpt::msafile_psiblast_example::begin::*/ #include #include "easel.h" #include "esl_alphabet.h" #include "esl_getopts.h" #include "esl_msa.h" #include "esl_msafile.h" #include "esl_msafile_psiblast.h" static ESL_OPTIONS options[] = { /* name type default env range toggles reqs incomp help docgroup*/ { "-h", eslARG_NONE, FALSE, NULL, NULL, NULL, NULL, NULL, "show brief help on version and usage", 0 }, { "-1", eslARG_NONE, FALSE, NULL, NULL, NULL, NULL, NULL, "override autodetection; force PSIBLAST format", 0 }, { "-q", eslARG_NONE, FALSE, NULL, NULL, NULL, NULL, NULL, "quieter: don't write msa back, just summary", 0 }, { "-t", eslARG_NONE, FALSE, NULL, NULL, NULL, NULL, NULL, "use text mode: no digital alphabet", 0 }, { "--dna", eslARG_NONE, FALSE, NULL, NULL, NULL, NULL, "-t", "specify that alphabet is DNA", 0 }, { "--rna", eslARG_NONE, FALSE, NULL, NULL, NULL, NULL, "-t", "specify that alphabet is RNA", 0 }, { "--amino", eslARG_NONE, FALSE, NULL, NULL, NULL, NULL, "-t", "specify that alphabet is protein", 0 }, { 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }, }; static char usage[] = "[-options] "; static char banner[] = "example of guessing, reading, writing PSIBLAST format"; int main(int argc, char **argv) { ESL_GETOPTS *go = esl_getopts_CreateDefaultApp(options, 1, argc, argv, banner, usage); char *filename = esl_opt_GetArg(go, 1); int infmt = eslMSAFILE_UNKNOWN; ESL_ALPHABET *abc = NULL; ESL_MSAFILE *afp = NULL; ESL_MSA *msa = NULL; int status; if (esl_opt_GetBoolean(go, "-1")) infmt = eslMSAFILE_PSIBLAST; /* override format autodetection */ if (esl_opt_GetBoolean(go, "--rna")) abc = esl_alphabet_Create(eslRNA); else if (esl_opt_GetBoolean(go, "--dna")) abc = esl_alphabet_Create(eslDNA); else if (esl_opt_GetBoolean(go, "--amino")) abc = esl_alphabet_Create(eslAMINO); /* Text mode: pass NULL for alphabet. * Digital mode: pass ptr to expected ESL_ALPHABET; and if abc=NULL, alphabet is guessed */ if (esl_opt_GetBoolean(go, "-t")) status = esl_msafile_Open(NULL, filename, NULL, infmt, NULL, &afp); else status = esl_msafile_Open(&abc, filename, NULL, infmt, NULL, &afp); if (status != eslOK) esl_msafile_OpenFailure(afp, status); if ((status = esl_msafile_psiblast_Read(afp, &msa)) != eslOK) esl_msafile_ReadFailure(afp, status); printf("alphabet: %s\n", (abc ? esl_abc_DecodeType(abc->type) : "none (text mode)")); printf("# of seqs: %d\n", msa->nseq); printf("# of cols: %d\n", (int) msa->alen); printf("\n"); if (! esl_opt_GetBoolean(go, "-q")) esl_msafile_psiblast_Write(stdout, msa); esl_msa_Destroy(msa); esl_msafile_Close(afp); if (abc) esl_alphabet_Destroy(abc); esl_getopts_Destroy(go); exit(0); } /*::cexcerpt::msafile_psiblast_example::end::*/ #endif /*eslMSAFILE_PSIBLAST_EXAMPLE*/ #ifdef eslMSAFILE_PSIBLAST_EXAMPLE2 /* A minimal example. Read PSIBLAST format MSA, in text mode. gcc -g -Wall -o esl_msafile_psiblast_example2 -I. -L. -DeslMSAFILE_PSIBLAST_EXAMPLE2 esl_msafile_psiblast.c -leasel -lm ./esl_msafile_psiblast_example2 */ /*::cexcerpt::msafile_psiblast_example2::begin::*/ #include #include "easel.h" #include "esl_msa.h" #include "esl_msafile.h" #include "esl_msafile_psiblast.h" int main(int argc, char **argv) { char *filename = argv[1]; int fmt = eslMSAFILE_PSIBLAST; ESL_MSAFILE *afp = NULL; ESL_MSA *msa = NULL; int status; if ( (status = esl_msafile_Open(NULL, filename, NULL, fmt, NULL, &afp)) != eslOK) esl_msafile_OpenFailure(afp, status); if ( (status = esl_msafile_psiblast_Read(afp, &msa)) != eslOK) esl_msafile_ReadFailure(afp, status); printf("%6d seqs, %5d columns\n", msa->nseq, (int) msa->alen); esl_msafile_psiblast_Write(stdout, msa); esl_msa_Destroy(msa); esl_msafile_Close(afp); exit(0); } /*::cexcerpt::msafile_psiblast_example2::end::*/ #endif /*eslMSAFILE_PSIBLAST_EXAMPLE2*/ /*--------------------- end of examples -------------------------*/